Alinhamento múltiplo de sequências
Um alinhamento múltiplo de sequências é um alinhamento de três ou mais sequências biológicas, geralmente proteínas, ADN ou ARN. De modo geral, assume-se que o conjunto de sequências de consulta que se coloca como entrada (conjunto problema) tem uma relação evolutiva pela qual compartilham uma linhagem e descendem de um ancestral comum. Do alinhamento resultante, pode-se inferir a homologia, e pode levar-se a cabo a análise filogenética para avaliar as origens evolutivas compartilhadas pelas sequências. As representações visuais do alinhamento ilustram mutações tais como mutações puntuais (uma só mudança de aminoácidos ou nucleótidos) que aparecem como diferentes caracteres numa só coluna do alinhamento, e a inserção ou supressão de mutações que aparecem como ocos numa ou várias das sequências no alinhamento. O alinhamento múltiplo de sequências utiliza-se para avaliar a conservação dos domínios proteicos, as estruturas terciárias e secundárias, e também aminoácidos ou nucleótidos individuais.
Os alinhamentos múltiplos de sequências também se referem ao processo de alinhá-las como um conjunto de sequências. Como pode ser difícil alinhar à mão três ou mais sequências de comprimento biologicamente relevante, e quase sempre consome muito tempo, utilizam-se algoritmos computacionais para produzir e analisar os alinhamentos. Os alinhamentos requerem metodologias mais sofisticadas que os alinhamentos de pares porque são computacionalmente mais complexos de produzir. A maior parte dos programas de alinhamento múltiplo de sequências usam métodos heurísticos em lugar de optimização global, porque identificar o alinhamento óptimo entre mais de umas poucas sequências de comprimento moderado é proibitivamente custoso computacionalmente.

Este texto é um excerto do artigo Alinhamento múltiplo de sequências da enciclopédia livre Wikipédia. Na Wikipédia, está disponível uma lista dos autores.
Em pt.wikipedia.org, o artigo Alinhamento múltiplo de sequências foi consultado 154 vezes nos últimos 30 dias. (Versão: 17.07.2013)
Imagens referentes a Alinhamento múltiplo de sequências
Imagem de visualização:
Original:
Resultados da pesquisa em Google e Bing
1
>30
1
Alinhamento múltiplo de sequências – Wikipédia, a enciclopédia livre
Um Alinhamento múltiplo de sequências é um alinhamento de três ou mais sequências biológicas, geralmente proteínas, ADN ou ARN. De modo geral ...
pt.wikipedia.org/wiki/Alinhamento_m%C3%BAltiplo_de_sequ%C3%AAncias
2
>30
2
Alinhamento múltiplo de seqüências - IFSC
Alinhamento múltiplos de seqüências. Qual a importância de se realizar alinhamentos múltiplos em oposição a alinhamentos em pares?
www.ifsc.usp.br/~rdemarco/FFI0760/alinhamento_global.pdf
3
>30
3
Alinhamento Múltiplo de Sequências - Instituto de Computação ...
6 set. 2012 ... desejamos encontrar o alinhamento de maior pontuaç˜ao possıvel. O problema do Alinhamento Multiplo de Sequências é também conhecido ...
www.ic.unicamp.br/~zanoni/mo640/2012/material/02-Alinhamento_Multiplo.pdf
4
>30
4
Alinhamento Múltiplo de Sequências Utilizando Algoritmos Genéticos
O Alinhamento múltiplo de sequências é uma das principais ferramentas nos ... O problema do Alinhamento múltiplo de sequências pode ser descrito como o ...
www.ic.unicamp.br/~zanoni/orientacoes/mestrado/sergio/PropostaSergio.pdf
5
>30
5
Alinhamento Múltiplo de Seqüências Protéicas Utilizando ... - pucrs
se ao alinhamento múltiplo de seqüências biológicas, em razão desta tarefa servir de ... O alinhamento múltiplo de seqüências é uma coleção de três ou mais ...
revistaseletronicas.pucrs.br/ojs/index.php/hifen/article/view/3783/2895
6
>30
6
Estratégia paralela para alinhamento múltiplo de sequências com ...
Título: Estratégia paralela para Alinhamento múltiplo de sequências com algoritmo genético multi-ilha. Autor(es): Miranda, Lídia Araujo. Orientador(es): Melo ...
repositorio.unb.br/handle/10482/5284
7
>30
7
Estratégia Paralela Exata para o Alinhamento Múltiplo de ...
O Alinhamento múltiplo de sequências biológicas é um problema muito importante em. Biologia Molecular, pois permite que sejam detectadas similaridades e ...
repositorio.unb.br/bitstream/10482/13153/1/2012_DanielSundfeldLima.pdf
8
>30
8
Bioinformatics Tools for Multiple Sequence Alignment < EMBL-EBI
Multiple Sequence Alignment (MSA) is generally the alignment of three or more biological sequences (protein or nucleic acid) of similar length. From the output ...
www.ebi.ac.uk/Tools/msa/
9
>30
9
ALINHAMENTO DE SEQUÊNCIAS
como múltiplo, de sequências, recorrendo aos conceitos de alinhamento local e global. ... determinou-se o alinhamento múltiplo de cinco sequências, tendo-se ...
web.ist.utl.pt/ist155746/relatorio_2_bc.pdf
>30
1
10
Dor de Costas - Coluna
Saiba mais sobre as possíveis causas da dor de costas. Descubra como tratar a dor na coluna.
www.coluna.com/dor-de-costas.html
Resultados da pesquisa para "Alinhamento múltiplo de sequências"
Google: aprox. 113.000
Alinhamento múltiplo de sequências na Ciência
[PDF]Untitled - Instituto de Computação - Unicamp
Universidade Estadual de Campinas. Alinhamento Múltiplo Progressivo de Sequências de. Prote´ınas. Maria Angélica Lopes de Souza1. Setembro de 2010 .
[PDF]Estratégia Paralela Exata para o Alinhamento Múltiplo de ...
Alinhamento múltiplo de sequências,. 3. Computaç˜ao de Alto Desempenho, 4. GPU. CDU 004.4. Endereço: Universidade de Brasılia. Campus Universitário ...
Estratégia paralela para alinhamento múltiplo de sequências com ...
Estratégia paralela para Alinhamento múltiplo de sequências com algoritmo genético multi-ilha. 2009. 97 f. Dissertação (Mestrado em Informática)-Universidade ...
[PDF]Sequência de Nucleotídeos
Universidade Federal do Rio Grande do Sul. Bioinformática – ... Tópico Avançado: Alinhamento múltiplo utilizando MUSCLE e T-Coffee. 1) Formato FASTA.
[PDF]ALGORITMOS EVOLUCIONARIOS MULTIOBJETIVO PARA ...
Dissertação - Universidade Federal do. Rio de Janeiro, COPPE. 1. Algoritmos Evolucionários Multi- objetivo. 2. Alinhamento Múltiplo de Seqüências.
[PDF]Alinhamento Múltiplo de Seqüências Protéicas Utilizando ... - pucrs
3 Universidade Estadual de Londrina (UEL) – Departamento de Ciência da ... se ao alinhamento múltiplo de seqüências biológicas, em razão desta tarefa ...
[PDF]Algoritmos para Alinhamento de Sequências - FLF
Algoritmos para Alinhamento de Sequências. Gerardo Valdisio Rodrigues Viana. Universidade Estadual do Ceará. Hélio Augusto Sabóia Moura. Faculdade ...
[PDF]Alinhamento múltiplo global de seqüências pela ... - BCC UFLA
1 mar. 2006 ... Computação da Universidade Federal de Lavras como parte das exigências ... ALINHAMENTO MÚLTIPLO GLOBAL DE SEQUENCIAS PELA.
[PDF]992 Align - Uma Ferramenta para Alinhamento Múltiplo de ...
Universidade Federal de Santa Catarina. Departamento de Informática ... MÚLTIPLO DE SEQÜÊNCIAS DE DNA E PROTEÍNAS. Daniel Haeser Rech. Rodrigo ...
[PDF]UNIVERSIDADE DE SÃO PAULO - ffclrp - USP
UNIVERSIDADE DE SÃO PAULO. FFCLRP ...... O alinhamento múltiplo de seqüências é realizado para tornar seqüências de tamanhos diferentes em um ...
livros referentes ao termo Alinhamento múltiplo de sequências
Bioquímica
Bioquímica
Donald Voet; Judith G. Voet
... EYRHDAS SVQHPAYEEGQTCLNCLLYTDASAQDWGPC SV-- FPGKLVSANGWCTAWVAR (e) Alinhamento múltiplo de seqüências pelo programa CLUSTAL X _MERLSEDD AAQALEYRHDASSVQ-H AYE--- EGQTCLNCLLYTDASAQIWVG ...
Animais na pesquisa e no ensino : aspectos éticos e técnicos
Animais na pesquisa e no ensino : aspectos éticos e técnicos
ANAMARIA GONÇALVES DOS SANTOS FEIJO, PAULO MARCIO CONDESSA PITREZ, LUISA MARIA GOMES DE MACEDO BRAGA, 2010
O Clustal é, hoje, um programa básico para alinhamento múltiplo global de sequências, que podem ser constituídas por nucleotídeos ou proteínas. Dizer que o alinhamento é global significa que as sequências envolvidas são alinhadas de ...
Conceitos de Genética
Conceitos de Genética
William S. Klug | Michael R. Cummings | Charlotte A. Spencer | Michael A. Palladino
Primeiro, você obterá dados de sequências de polipeptídeos da histona H4 das diferentes espécies e fará um Alinhamento múltiplo de sequências para compará -Ias. Depois, você construirá uma pequena árvore filogenética, usando um ...
Fundamentos de bioquímica: A Vida em Nível Molecular
Fundamentos de bioquímica: A Vida em Nível Molecular
Donald Voet; Judith G. Voet; Charlotte W. Pratt
Esse arquivo deve ser um arquivo de texto simples, com as seqüências individuais separadas por uma linha em branco. 2. Alinhamento de Seqüências Múltiplo. Alinhamento de seqüências múltiplo é uma ferramenta para identificar resíduos ...
Biologia Molecular da Celula
Biologia Molecular da Celula
Bruce Alberts | Alexander Johnson | Julian Lewis | Martin Raff | Keith Roberts | Peter Walter
Um programa de alinhamento de sequências - os mais populares são BLAST e FASTA - rastreia o banco de dados por ... 0 desafio substancial e importante para predizer as estruturas de proteínas que são grandes ou têm múltiplos domínios,  ...
Desenvolvimento de consultas Google


Registos de blog referentes ao termo
Alinhamento múltiplo de sequências
Bibliografia - Unirio
www.unirio.br/unigen/bioinformatica/2009/08/bibliografia.html
Bioinformática Estrutural & Química Medicinal: II Escola e Bioinformática Estrutural da Ulbra
Programa preliminar 07/05 (10h às 12h) – Aula Teórica: Introdução à Modelagem Molecular e à Bioinformática – Definições básicas; o dogma central da biologia molecular, genômica, proteômica, bioinformática modelagem molecular, bioinformática estrutural, quimioinformática. LaBiE 07/05 (14h00min às 16h00min) – Aula Teórica: Bioinformática: bancos de dados de seqüência, matrizes de substituição, alinhamento de seqüências.
bioinformaticaestrutural.blogspot.com/2012/04/1-semana-segunda-0705-10h-as-12h-aula.html
Você sabe o que é Phylo? |
Phylo é um jogo desenvolvido pelos Drs. Jerome Waldispuhl e Blanchette Mathieu, da Universidade McGill, no Canadá, e, embora, pareça simples, consistindo na combinação de quadrinhos coloridos, tem o objetivo de utilizar o poder computacional do ser humano para resolver o problema do alinhamento de múltiplas seqüências para DNA, RNA e proteínas. Através deste tipo de…
bloglbmg.wordpress.com/2012/10/31/voce-sabe-o-que-e-phylo/
Inteligência Computacional: BIOINFORMÁTICA
Desde o início até meados do século passado os geneticistas e químicos se questionaram sobre a natureza química do material genético. Das pesquisas desenvolvidas, surgiu a conclusão de que o DNA era a molécula que armazenava a informação genética e, em 1953, sua estrutura química foi desvendada no clássico trabalho de Watson e Crick.
icufrj.blogspot.com/2010/12/bioinformatica.html
Portal BioInfo - Dedicado às notícias de Bioinformática, Biologia, Genética e Informática - Alinhamento Global
Portal BioInfo, dedicado a noticias de Bioinformática, Biologia, Genética, Biotecnologia e Informática
www.bioinfo.com.br/modules.php?name=News&file=article&sid=770
Genetics Made Easy: Resumo e Lista de Programas de Análises Genéticas
Esta é uma lista de programas de análises genéticas que estou utilizando ou testando. Pretendo, espero que em breve, fazer uma análise maior de cada programa quando explicar os principais passos de utilização dos mesmos.
mrcroftux.blogspot.com/2010/03/resumo-e-lista-de-programas-de-analises.html
Gestão & Produção - Alignment between project management organizational structure and manufacture strategy: a comparative analysis of multiple cases
www.scielo.br/scielo.php?pid=S0104-530X2009000200012&script=sci_arttext
Mundial de Motovelocidade – Os locais Young (MotoGP) e Rispoli (Moto2) vão alinhar como convidados em Indianápolis… : Mundomoto
www.mundomoto.esp.br/?p=60811
Análise Técnica: Alinhamento Automático com média móvel e estocástico Bovespa
Considero o alinhamento automático a forma mais segura para entender o movimento dos preços das ações. No último artigo desta série prometi que usaria alguns gráficos para ilustrar essa metodologia....
www.investmax.com.br/iM/content.asp?contentid=872
Ácido desoxirribonucleico - 1 Propriedades físicas e químicas 1.1 Emparelhamento de bases 1.2 Sulcos 1.3 Senso e antissenso 1.4 Superenrolamento 1.5 Estrutura alternativa da dupla hélice 1.6 Estruturas em quadrúplex 2 Modificações químicas 2.1 Modificaçõe
Ácido desoxirribonucleico Estrutura de um ADN. O ácido desoxirribonucleico (ADN, em português: ácido desoxirribonucleico; ou DNA, em inglês: deoxyribonucleic acid) é um composto orgânico cujas moléculas contêm as instruções genéticas que coordenam o desenvolvimento e funcionamento de todos os seres vivos e alguns vírus.
www.trampoescolar.com/2013/06/acido-desoxirribonucleico-1.html
123